PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10020856m
Common NameCARUB_v10020856mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 248aa    MW: 28446.4 Da    PI: 9.7488
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10020856mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++++++G g W+ ++ + g++R++k+c++rw++yl
  Carubv10020856m 11 KGSWTAEEDSLLRQCINKFGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 58
                     799*******************************************97 PP

2Myb_DNA-binding46.58.5e-1564109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E +ll++++++lG++ W++Ia +++ gRt++++k++w+++l
  Carubv10020856m  64 RGKLSSDEVDLLLRLHRLLGNR-WSLIAGRLP-GRTANDVKNFWNTHL 109
                      78999*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.753662IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-21761IPR009057Homeodomain-like
SuperFamilySSF466893.48E-2710105IPR009057Homeodomain-like
SMARTSM007176.2E-151060IPR001005SANT/Myb domain
PfamPF002491.4E-151158IPR001005SANT/Myb domain
CDDcd001673.43E-101358No hitNo description
Gene3DG3DSA:1.10.10.606.7E-2262112IPR009057Homeodomain-like
SMARTSM007176.2E-1463111IPR001005SANT/Myb domain
PROSITE profilePS5129419.70363113IPR017930Myb domain
PfamPF002491.6E-1364109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009745Biological Processsucrose mediated signaling
GO:0009753Biological Processresponse to jasmonic acid
GO:0019430Biological Processremoval of superoxide radicals
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEGSSTKVLR KGSWTAEEDS LLRQCINKFG EGKWHQVPLR AGLNRCRKSC RLRWLNYLKP  60
NIKRGKLSSD EVDLLLRLHR LLGNRWSLIA GRLPGRTAND VKNFWNTHLS KKHEPCCKIT  120
QIKKRNITSH PTTPAQKINV YKPRPRSFLV NNGSSSLNGR PKVNVITPSF GINNNKVCEN  180
NMTCNKDKEK AEHSNNLIDE DHIWLENLLE ETQEVDDLVR EVTATEKGLT LGFDVEQLWN  240
MFDGEFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2091125107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302744.10.0hypothetical protein CARUB_v10020856mg
SwissprotQ9FE251e-127MYB75_ARATH; Transcription factor MYB75
TrEMBLR0GID00.0R0GID0_9BRAS; Uncharacterized protein
STRINGscaffold_201358.11e-128(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.11e-128production of anthocyanin pigment 1